PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0756s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 208aa    MW: 23065.7 Da    PI: 9.2699
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0756s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.44.5e-122573796
                         EEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3 37 tledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                         +l +e+  sW+v++    + g+y l +GW+ Fv +ng++ gD++ Fkl++  + e++v+v
  Kaladp0756s0009.1.p  2 VLHTETRSSWSVNI--VANTGGYKLCGGWSAFVIDNGINKGDICEFKLMS--RLEMWVQV 57
                         7889999*******..99999**************************986..67778887 PP

2B360.13.8e-19112202195
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f++++ + +v   ++l +p +f++e++++  ++ +++l++e+g sW+v++    + g+y l +GW+ Fv++ng+k gD++ Fkl++r   
  Kaladp0756s0009.1.p 112 FLTKMQRYNVEYGRILNIPMHFVRENSLSYCTDEKMVLRTETGSSWSVNI--VANMGGYKLCGGWSAFVSDNGIKKGDVCEFKLMSR--L 197
                          5666656666666788**********888888889***************..99999**************************9874..4 PP

                          ..EEE CS
                   B3  91 elvvk 95 
                          e++v 
  Kaladp0756s0009.1.p 198 EMRVE 202
                          44554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF023621.1E-9157IPR003340B3 DNA binding domain
SuperFamilySSF1019366.28E-12158IPR015300DNA-binding pseudobarrel domain
CDDcd100175.23E-9157No hitNo description
Gene3DG3DSA:2.40.330.103.1E-11157IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.308161IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.4E-22105203IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20106203IPR015300DNA-binding pseudobarrel domain
CDDcd100171.91E-18110203No hitNo description
PfamPF023624.0E-17112200IPR003340B3 DNA binding domain
SMARTSM010191.9E-12112207IPR003340B3 DNA binding domain
PROSITE profilePS5086313.422112207IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MVLHTETRSS WSVNIVANTG GYKLCGGWSA FVIDNGINKG DICEFKLMSR LEMWVQVTPN  60
PKVASRTSRN GPLSCPPRNA EVKLRTVKPE LEHVIQNALK AADASSIGPP SFLTKMQRYN  120
VEYGRILNIP MHFVRENSLS YCTDEKMVLR TETGSSWSVN IVANMGGYKL CGGWSAFVSD  180
NGIKKGDVCE FKLMSRLEMR VEVTPKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.14e-18B3 family protein